dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A014FGE1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A014FGE1|A0A014FGE1_9GAMM) STAS domain protein {ECO:0000313|EMBL:EXT61881.1} KW=Complete proteome OX=1310914 OS=Acinetobacter sp. 25977_10. GN=J813_4216 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence length 131
Sequence
MIATVVVVVATHNLALGVLTGVLLSALFLANKLENDVHVITSLEGNYRLYDLRGQIFFSS
SDKFMQSFNFKEEVKEVIIDLTHSRIWDITSVAMLDSAVERFQKNGIQVTVRGLNEANSV
MIDKYGTHAKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]