dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A017S506 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A017S506|A0A017S506_9EURO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EYE92078.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_415781 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence length 271
Sequence
MSTVELASSFIEGAPPGELSDVVADVKALTSEEGDLIPSLAPAFERYNETQLATVKLPGA
SQEVIVSEFNKLEGNRYFDVESQTSFEVDHVTQEASDAQSYVLESQNADLIKSLLKSLSV
HATEHYPSSSYGVYPTADDSAVAILLVANRYSPNNFWNGRFRAIYTMPVSEPATVTGKVH
VDVHYYEDGNVALNTTKPISVSISSLSAETVISRIAAAERDYQETLNRAFVQMAEEAFKN
LRRQLPITRQKVEWEKVGGYRLGQDISGGKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]