dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A017SWU4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A017SWU4|A0A017SWU4_9DELT) RsbR, positive regulator of sigma-B {ECO:0000313|EMBL:EYF01439.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_8272 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence length 280
Sequence
MSALLSLLTSMDWSSSRALQQLIDAIPDPIFVKDLQHRWIACNAGLCKLLGQPYEKVIGH
SDPEYVTAEQAAEFWAHDDLVFRTGKPDDNEETHTIEGGQTRTIWTRKFPIKNAAGEVTG
LCAIITDITEIKQRLGEAERIERENAAQRLTIAAQAALLDRMAVPVLQVWQGILLVPLVG
EINARRAATALTNLLDAVVQHHAAFALLDLTGVLVFDGEVARYLARTVQATELLGCECVL
VGIGPEIARTLVSLNIHIEGVATRGTLQGGLAYAKERLSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]