dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A021X5H0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A021X5H0|A0A021X5H0_9RHIZ) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1410620 OS=Shinella sp. DD12. GN=SHLA_33c000740 OC=Rhizobiaceae; Shinella.
Sequence length 362
Sequence
MVLPGKKIRVLIIDDSASVRQALTHVLEQDPEIEVMGAASDPFMAAKKIQEEVPDVITLD
VEMPRMDGITFLRKLMSQRPIPVVMCSSLTEEGSETLMQALEAGAVDIILKPKIGAADHL
AESGTRIREAVKGAAVARLGQSRRSAAASGPTAKLTADAVLPPPSGRAMAKTTEMVACVG
ASTGGTEALRVLLEQLPANSPGIVIVQHMPEKFTAAFAKRLNSLCEVEVKEAVHGDPVLR
GHVLIAPGDRHMMLERQGARYHVAVREGPLVSRHRPSVDVLFRSAARSAGANAMGVILTG
MGDDGARGMNEMHQAGAYTVAQDEASSIVFGMPKEAIAHGGVDRILPLDQIAREILAADR
RR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]