dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A022XJ47 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A022XJ47|A0A022XJ47_TRISD) Uncharacterized protein {ECO:0000313|EMBL:EZF70682.1} KW=Complete proteome OX=1215331 OS=Trichophyton soudanense CBS 452.61. GN=H105_07122 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence length 939
Sequence
MASKASNAGLEAKTPSKSRSKSRSKSRSPGPKGASKQSKTHDYRSDGVKDYDVLNLPVSD
YKIMLVITAIATVVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLA
GHLAGFKGDFDFKEIGKDYLEPGVPYVAMRMLPAIMGIMTVPTMFLTLKATGCRTSTASF
GALLVTFENALVTQSRFILLDSPLIIFTALTVLSFVSFSNQHEQGPPKAFGCSWWFWLVA
SGLFLGATASVKWVGLFTIAWVGSLTLIQLWVLLGDSKTVTPHLWFKHFFARALCLIVIP
VGLYMAMFGIHFLCLRNPGEGDGFMSSEFQATLNSKGMGDTPVDVVFGSRVSIRHHNTQG
GYLHSHSHMYPGGSKQQQITLYPHKDDNNIFILENQTQPLGPYGQVPGPRAWDNITTEHI
MDGDTIRLYHMATDRRLHSHDVRPPVTEADWQQEVSAYGYEGFEGDANDLFRVEIVPSMS
DGAEAKKRLRTIQTKFKLVHVMTGCVLFSHKVKLPEWGFDQQEVTCAKGGSLPNSIWYIE
QNSQPALPDDVEKVNYKIPNFFAKFWELHKVMWRTNAGLVDSHAWDSRPPSWPILSRGIN
FWGRHHRHVYLIGNPVIWWTSTAAVVIWVVFKGIAVLRWQRGFKDYNHVHFKRFDYEIGQ
TLLGWALHYFPFYLMARQLFLHHYLPALYFAILAFCQIYDFVANRFNKPSIFGKLFTVAF
LSLSVAAFCILSPLAYGNPWTKGMCQKTKLISTWDFDCNLFHNDLSQYAIPEVINTSEAA
PTSIAAPPVQQEQQQGGQQQEQQPEQQANQVPVQPESPQQPPAVDPDLRKVREVEYRDSE
GNILSEEQVKALQEQGEISFETRYETRTRLIDNEGRELPKEAIIAPEHPDVQGANPETVA
KDELKAPANKPAEVKGENESPKKKENKPKPASEAKAATN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]