dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A023WX68 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A023WX68|A0A023WX68_PSEST) Sulfate transporter {ECO:0000313|EMBL:AHY44822.1} KW=Complete proteome OX=316 OS=Pseudomonas stutzeri (Pseudomonas perfectomarina). GN=UIB01_21025 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 495
Sequence
MLQSIKQNWFSNVRGDVLSGLVVALALIPEAIAFSIIAGVDPRVGLYASFCIAVVIAFTG
GRPGMISAATGAMALLMVTLVREHGLQYLLAATLLCGVLQIVAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYLFPYVPKLGKVIPSPLVCILSM
TAVAVYFGLDIRTVADMGDLPDTLPVFLWPEVPLTFETLAIIFPYSAALAVVGLLESLMT
ATIVDDLTDTGSDKNRECKGQGVSNIVSGLFGGMAGCAMIGQSVINVKSGGRTRLSTLIA
GVVLLLMVVFLSDWVGQIPMAALVAVMIMVSIGTFSWDSLRNLKKHPLSTNIVMVVTVVV
VVFTHNLAYGVLAGVLLAAMFFANKVGHYLHIGSELDATGNQRTYMVIGQVFFSSSDKFT
GAFDFKEALGKVTIDLSRAHFWDITAVAALDKVVIKFRREGTEVEVLGLNEASATIVDRF
GVHDKPEAIDKLMSH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]