dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A031LS52 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A031LS52|A0A031LS52_9GAMM) Sulfate transporter {ECO:0000313|EMBL:EZQ11207.1} KW=Complete proteome; Reference proteome OX=466088 OS=Acinetobacter sp. Ver3. GN=CL42_05550 OC=Moraxellaceae; Acinetobacter.
Sequence length 481
Sequence
MIYLKKDQWFSNIRTDVLAGLVVGLALIPESIAFSAIAGVDPQVGLYASFCIAVTIAFFG
GRTAMISAATGAMALLMITLVKEHGLQYLLAATILTGVIQIIAGYLKVAKLMRFVSQSVV
YGFLNALAILIFIAQFPEIAQMNSLGYIFLAIGLLVIYAFPHLPKIGKIIPSPLVCIIVL
SVLALLLGADMRTVSDLGAFPDTLPVFLIPEIPFSLDTLLIILPYSLTLATVGLLETMMT
TTVIDEMTESEGDRHQECRGQGIANMVSGFMGGMAGCAMIGQSIINVSSGARTRLSTLVA
GVFLLCLVVFFKDWLAYIPMAALVAIMIMVAFTTFNWDSVKNFRKHPVQSNVVMLTVVMI
VLATHNLALGVLIGVILSALFLINKLESEVKVQSELENHVRYYTVKGQIFFSSAEIFYAF
FDFKEDIKQVEIDLSYAHIWDITSVNMLANVVAKFEAQGTQVRVIGLNQASVTLIERISN
T

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]