dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A044TN10 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A044TN10|A0A044TN10_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC517} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence length 205
Sequence
MFSEFLVASVLYFIAINASQIIDAVTCGSVVKLKNNQEGVRLHSHDVKYGSGSGQQSVTA
VENGDDVNSHWQILPAIKETCKRGEPVKCGSKIRLKHLTTGSYLHSHFFAAPLTKENQVE
VSCFGNTESSDSGDHWIVVCSNDVWLRKDAVKLKHEDTGKFLAISGERYGRPIDGQYEVV
AISASKSTALWKTAEGIFMVGPDIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]