dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059G703 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059G703|A0A059G703_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KDA02494.1} KW=Complete proteome OX=1280953 OS=Hyphomonas oceanitis SCH89. GN=HOC_09749 OC=Hyphomonadaceae; Hyphomonas.
Sequence length 1152
Sequence
MKHREVTLDDKYELVEGNAFMTGIQALVRLPLDRKRLDIGSGHNTAGFISGYRGSPLGGY
DQQLRAVQPLLDSHNIQFWEGLNEDLGATAVWGSQQLGLFPGARYDGLFGIWYGKAPGVD
RTGDVFKHANAAGTSALGGVLAIIGDDHNCKSSTLPSQSEFAMADAEIPVLNPASIQDVL
DYGIHGWNMSRFSGAWTGLVALADTMDSGSVVNVSLDRFAFAEPGFHMPEAGVHMRRGDT
PLDKEARLRHFKLPAAQAYVRANRLDHVVIPSPKPRIGVIVTGQAARDVFEALAAIGLSP
EEAGRLGLTVYKVAMPWPLEPEGVREFCAGLERVVVIEHKRPLIEEQLKAALYDLPDSQR
PRIEGKRAANGEPLLSDVASISIPEMAHALMKIIPAGWDTARADAYFDRVGRAGEAARGN
ASETVRSPHFCSGCPHNTSTTVPEGSRALAGIGCHYMANFMPDRKTDMTSQMGGEGIAWV
GQHWATDEDHVFVNLGDGTYSHSGSLAIRAAVTSGAKMTYKILYNDAVAMTGGQHVESGQ
TPAQIAQQVEAEGVKTIVIVTEDPTRYAGVKNLPRSVKIFDREDLEDVQVMLRATPGVSV
MIYDQMCATEKRRRSKRGIIAPDRVRVIINTEVCEGCGDCSIKSNCLSVEPVETELGRKR
RINQSSCNTDLSCLTGFCPSFVTVKDGEPAWTGEVRREFDASNLPLPETPSLAAPWNVLF
TGVGGTGVTTVAAVLAMAAHVDGNAASSLDMTGLAQKGGPVLSHIRFAREPEDISTGRVP
PASADLIIACDLVVAAGGDALLLMDPTRTAAYANSDVTPTSEFIRNRSKRFESDLLAGRV
KRQARDFGAFDAEALAVGYLHDAIYTNMIMVGYSWQKGAVPVSLRGLYRAIRLNGTKVDD
NMAAFNIGRIAAAAPERLAQQHDPRGHLEPKTLDELIDDRAKRLTAYQNAAYAQAYRDAV
TRVRSAEEAAGLGDKLTRAAATYAYKLMAYKDEYEVARLYTDGSFAAQLASQFKGGKLRF
WLAPPIMSKKDSHGHLKKKHFGGWMMLGFKLLTKLKGLRETPFDLFGRTEERKMERALRD
TYLETLETLASGLTVKNHAVAVAIAEVPDEIRGYGHVKEAAVAVASETEAALWKGWPTGD
MPKAKTTLIAAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]