dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059UUM7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059UUM7|A0A059UUM7_PSEPU) Seryl-tRNA(Ser/Sec) synthetase {ECO:0000256|HAMAP-Rule:MF_00176} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=BIW19_17225 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 426
Sequence
MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ
AKAKGEDIAPLMADVERMANELAAGKTELDGIQAELDGILLTIPNLPDASVPVGASEDDN
VEVRRWGTPKAFDFEIKDHVALGEVSGGLDFEAAAKLSGARFAVLRGPVARLHRALAQFM
INLHTGEHGYEEHYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADFYLIPTAEVSLTN
LVAGEILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVEPSKSMEA
LEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREISSCSNCGD
FQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPYMG
GVEVIR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]