dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059UY82 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059UY82|A0A059UY82_PSEPU) Aldo/keto reductase {ECO:0000313|EMBL:AHZ77520.1} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=DW66_3011 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 336
Sequence
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRAEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNALDATLTRMDMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEACHIAERLGVPRPVVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPDAGSRAGRQDKRIMEVEW
RQESLAIARQIQAYVEAKGVGIVEFAIAWVLNNRLVSSAIVGPRTEEQWDTYGGALAVKI
TAEDEAFIDSLVTPGHASTPGFNDVAHFVSGRITVH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]