dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059V2X5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059V2X5|A0A059V2X5_PSEPU) Transport system permease {ECO:0000313|EMBL:AHZ79420.1} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=DW66_4922 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 345
Sequence
MKQRVQPRTLFVCLGLLCLLAVWLSLALGPVSLPLFDTLRAGLRLLGLPIAADGLQQAEM
ILGQIRLPRTLLGLAVGAVLALSGVAMQGLFRNPLADPGLVGVAAGAAVGAAVAIVGGSW
LGGMPDVLAPYLLSLCAFIGGLGVTALVYRLGRRDGQTNVATMLLAGVAMTALGGAAVGL
FSYLADDATLRTLTFWNLGSLNGASYQRLWPLLLVAAGVAVWLPRRAKALNAMLLGESEA
RHLGIDVERLKRELVFCTALGVGAAVAAAGLIGFIGLVVPHLVRLLAGPDHRVVLPASLL
AGGALMLFADLAARLLLAPAELPIGIVTAFIGAPFFLFLLIRGRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]