dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A059V507 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A059V507|A0A059V507_PSEPU) Glutathione S-transferase domain-containing protein {ECO:0000313|EMBL:AHZ78988.1} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=DW66_4487 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 209
Sequence
MSNPIKLYNFPKSGHAHRIELMLSLLNLPTELVFVDLAKGAHKQPDFLALNPFGQVPVID
DNGTVIADSNAILVYLAKKYDNGTWLPEEPAAAARVQRWLSVAAGPLAFGPAAARLVTVF
GASFNTDEVITRAHTLLKVIDAELAKTPFLAGSTPTIADIANYSYIAHAPEGNVSLEPYA
NVRSWLARIEALPRFVPMPRTVIGLQTSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]