dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A061H1C6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A061H1C6|A0A061H1C6_9BASI) Uncharacterized protein {ECO:0000313|EMBL:EPQ26078.1} KW=Complete proteome; Reference proteome OX=1277687 OS=Anthracocystis flocculosa PF-1. GN=PFL1_06286 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Anthracocystis.
Sequence length 425
Sequence
MPSDRLSAAARLLVQAPPGQVSQVYHDLRGILLDPEAGADDGQTIDDAQIKHMALVALEE
YNTSQLIPVAIDEAAKDHVIICQAAQIPSSTDTATKRYAHPRAKKSFAFDHMARTASDIQ
DLPVDEDAEPLRAALDAALQNYVADRYNSGVSSVFAVSNVPYKPAAPTAAASSDAQQQQH
EEAAKVDAEDPAVPTAAAAANEDAETEGAEKKGDGSPNQEGDATAADDDGDNVKDDPVEA
AAASEAVSSDSTSPTAAAAEEARDASEQQQPQEQEPETTPRQIKYTFHHVGNKYHLSNFW
SGRWRASYTLDVEAATLTSSLQVQVHYFENGNVQLNASKPKTFHLDQSSLAGEGSESEHV
KRVAEHVVKLVERHEDDYQSLLEETYEDLGEKAFKALRRQLPLTKNKIDWNQLMNYRLGA
ELARQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]