dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A061JLJ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A061JLJ6|A0A061JLJ6_PSEST) MFS transporter {ECO:0000313|EMBL:EWC40606.1} KW=Complete proteome OX=1218352 OS=Pseudomonas stutzeri KOS6. GN=B597_014130 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 1161
Sequence
MSLAEIRLDDKYRLATGHLYLTGTQALTRLPMLQHQRDQARGLNTGGFISGYRGSPLGGL
DKSLWEARDYLKQHAIHFQPGVNEELAATAVWGSQQTNLFPGAKYDGVFAMWYGKGPGVD
RAGDVFKHANAAGVSPHGGVLLLAGDDHGCKSSTLPHQSEHAFIAASIPVLNPANVQEIL
DYGIIGWELSRYSGCWVALKTIAENVDSSAVVEVDPLRMQTRIPDDFELPEDGVHIRWPD
PPLAQEKRLNLYKIYAARAFARANNLNRVMLDSPNPRLGIITTGKSYLDVRQALDDLGLD
EALCARVGLRVLKVGMSWPLEPVSVHEFAQGLDEILVVEEKRSILEDQLTGQLYNWPVDK
RPRVVGEFDEQGSSLLPNLSELTPAMIARVIAKRLAPIYTSDSIQARLAFLDAKEKALAA
RSYSTVRTPHYCSGCPHNSSTKVPEGSRASAGIGCHYMVQWMDRRTETFTQMGGEGVNWI
GQAPFTDTPHMFQNLGDGTYFHSGSLAVRAAVAAGVNITFKILYNDAVAMTGGQPIDGEL
RVDQLSRQIADEGVKRIALVSDEPDKYPSRDTFAPITSFHHRRELDAVQRELREFKGVSV
IIYDQTCATEKRRRRKRGKLEDPAKRAFINPAVCEGCGDCGEKSNCLAVLPLETELGRKR
EIDQNACNKDFSCVEGFCPSFVTVHGGGLRKPEAVAGGIEAATLPEPRHPSLERPWNVLI
PGVGGSGVTTLGALLGMAAHLEGKGCTVLDQAGLAQKFGPVTTHVRIAARQSDIYAVRIA
AGEADLLLGCDLVVAAGDESLTRLNERISNAVVNSHESATAEFTRNPDAQVPGAAMRQAI
SDAVGADKTHFVDATRLATRLLGDSIATNLFLLGFAYQQGLLPISAEAIEKAIELNGVSA
KLNLQAFRWGRRAVLEREAVEQLARPVEAAGSSLAGPICKTLEEIVDWRVDFLTRYQNAG
LARRYRQRVERVREADSADDLALSKAVARYYFKLLAYKDEYEVARLYSEPEFRQQLEAQF
EGDYRLQFHLAPAWLAKRDPVTGEPRKRELGPWMLNVFGVLAKLRFLRGTPLDPFGYGHD
RRVERQLISEYENTVDELLAQLKPTNYRTAVAIAALPEQIRGYGPVKERSIAKARQQEKL
LRDQLAKGDEVQSVRLFQPAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]