dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A062U8I6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A062U8I6|A0A062U8I6_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KCZ54053.1} KW=Complete proteome OX=1280946 OS=Hyphomonas beringensis. GN=HY29_03000 OC=Hyphomonadaceae; Hyphomonas.
Sequence length 364
Sequence
METSDEETILHVSGDWTVRTVQAVDADLRALSHTGRVVLDVSELGQLDTAGAFVLDRTAR
QLSDDEPEIRGQHSVADNLISQVHAVTDVEEPKRKRSGGLIDMLERTGRGVHHVLQEGVA
TLAFLGETMVTTTRLLLTPWKLRWTSIVAVMEEAGLDAMPIVAFLSFFVGLVVAFIGATT
LRDLGSQVFTVELVGYAMFRELGVLLTGIVLAGRTNSSFTAQIGTMKMRQELDAMQTLGL
KPMEVLVTPRIIAMVVVTPVLAFVGTLSGVLGGIIVSWLTLDINPTLFLDRLQNTVPIEQ
FWIGMSKAPVFGFVVALIACRQGLNVGGSVQSLGSKTTTSVVQAIFSIIVIDALFAIFYM
EMGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]