dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A064CPD3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A064CPD3|A0A064CPD3_9MYCO) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KDF01532.1} KW=Complete proteome OX=1440774 OS=Mycobacterium aromaticivorans JS19b1 = JCM 16368. GN=Y900_022005 OC=Mycobacterium.
Sequence length 648
Sequence
MGPNGNGAAGNRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQPNYPAEIRA
PQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANIGDLPRGGLVIANSDEFTK
RNLAKVGYESNPLESGELDDYVVQAVAMTTLTLGSVEAIGASKKDGQRAKNMFALGLLSW
MYGRPIETSETFIREKFARKPDIAEANVLALKAGWNYGETTEAFGTTYEISPAKLAPGEY
RQISGNTALAYGVIAAGQLADIQVVLGTYPITPASDILHELSKHKNFNILTFQAEDEIAG
VGAAIGASYGGALGVTSTSGPGISLKSEAIGLAMMAELPLLVIDVQRGGPSTGLPTKTEQ
ADLLQVMFGRNGESPVAVLAASTPSDCFEVAIEAARIALTYRTPVILLSDGAIANGSEPW
RIPDIDSFKPIDTNLAEAGEDFQPYARDPETLARQFAVPGTPGLEHRIGGLESANGSGAI
SYEPANHDLMVRLRQAKIAGITVPDVTVDDPTGDAELLILGWGSSFGPIGEACRRARRRG
IKVAQAHLRHLNPLPANLGEVLRHYKNVVVPEMNLGQLALLLRGTYLVDVQSVTKVEGMA
FLADELEGIIDAALDGTLAEKESDKAKFARLAAATVGTGTDVGAGVNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]