dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A066XH75 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A066XH75|A0A066XH75_COLSU) Putative dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KDN65375.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_07268 OC=Colletotrichum.
Sequence length 951
Sequence
MSATKPVRSPSPKFDKPANGANGINGKASVEREPSYKSDGVEDNDVFLLPVSDYQIMLGL
TFLAAIIRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKMLIALTGWLAGFN
GDFDFKEIGKDYLEPGVPYVAMRMFPAVCGILLAPLMFLTLKTTGCRTTTALMGSCLIIF
ENGLLTQARLILLDSPLMVATAFTALSFQSFTNQHEQGPEKAFQLSWWFWLLMTGLGLGT
TVSIKWVGLFTIAWVGSLTLIQLWVLLGDTKNVTPRLWAKHFMARAFALIIIPVGFYMAM
FAIHFLCLVNPGDGDGFMSSEFQSTLNSKGMQDVAADVAFGSRVSIRHVNTQGGYLHSHP
LMYPTGSKQQQITLYPHKDENNIWLLENQTQPLGVNGEQINGTQAWNSLPEPVFIKDGDV
IRLYHTPTFRRLHSHDVRPPVTEADWQNEVSAYGYEGFEGDANDLFKIEIVKKQSLSPIS
KERLRTIETKFRLVHIMTGCVLFSHKVKLPEWASEQQEVTCARGGTLPNSLWYIEYNEHP
QLTGDNVEKVNYRNPGFFGKFWELQKVMWKTNAGLVESHAWDSRPSAWPLLKRGINFWGR
DNRQIYLLGNPIVWWSSTLAVVVYVLFKGIATLRWQRKCNDYAHTTFKRFDYEIGTAVLG
WAFHYFPFYLMDRQLFLHHYFPALYFAVMAFCLTFDFVTARVSFGGIRNNPVFNRVSAVA
FLALTIVGFVLFSPLAYGNPWTKAECNRVKLLGSWDFDCNTFHDNYSQYTPLLTRKSSAS
GATPTPAKSEAPAAPVGGQMGQIPIVDAPKEQPKEAARSGAAGQKVLSREEKVEYRDQNG
NLLNEEQVEALKGKVEFKTKYETRTRVVDASGNEVQMPEGGWPQELGQDQGGNVAPPHPD
VQGVDPETKVKVDESVVPKAAESVQGQKEAEQKKARPASDGGKEATAQEEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]