dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A067QNK9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A067QNK9|A0A067QNK9_9HOMO) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KDQ65152.1} KW=Complete proteome; Reference proteome OX=933084 OS=Jaapia argillacea MUCL 33604. GN=JAAARDRAFT_116400 OC=Agaricomycetes; Agaricomycetidae; Jaapiales; Jaapiaceae; Jaapia.
Sequence length 762
Sequence
MAASVRVRRPPSPPPHAPSQHSNRFPHTREDHLDADARREAASKGYSRSTLSRKAYPSGG
LKVTSGEWKLLAVVIIIALGVRLFRISKPDSVVFDEVHFGKFASKYIKTQYFVDVHPPLA
KLLITLAGFIFGYDGNFDFKDIGKTYENVPYVAMRLLPALLGVATIPLSYLTLRALDCRA
TTALLASSLLTFENGLITQSRHILLDSPLVFFTALTTFFWTGFSNEEHHQPFTQSWWTWL
TLTGLSLGAVVSCKWVGLFTIATVGLGTVRQLWLLLGDLRVGPRLWIKHFLARALCLIAV
PTIFYMSMFWIHFAILQNSGEGDGFMSSEFQHTLGGRGMADTFADVAIGSEVTIRHVNTQ
GGYLHSHPHNYPGGSQQQQVTLYPHRDTNNDWRIVNATAEGDPDFDWEEQPLTYIPSGSR
IKLRHLLTQKHLHSHDYRPPVSDVDFQNEISAYGMPGFAGDANDDWYLELESDSYGRGRG
DRESGKRLRTLRSVFRLRHALTGCYLFSHKVKLPEWGYEQQEVTCNKNAVKENSLWFVET
NIHPKLPKDAPKVNYKLPGFLGKFLELQQVMWTTNAGLTDRHTYDSRPDSWPRLRRGINF
WVKDHRQIYLMGNPTVWWLSSVAVVLYAGVRAFLILRAKRGYRDFENTKVSKYDGLCGFL
FIGWFLHYFPFFLMGRQLFLHHYFPALYFAVLLLASVFDLLTSNLRPKIRLQIAAVLIFA
AFWNFTYFSPLVYGNPWTKTKCLNARWFKTWDFAWYVGSFVE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]