dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A068V763 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A068V763|A0A068V763_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP15703.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00015700001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence length 129
Sequence
MAISFFGLAIFLFLTLDSDFTSSPISTASEGVQITYGSVIKLMHERTTFRLHSHDVPYGS
GSGQQSVTGFPNVDDSNSYWIVRPVPDTNAQQGDTIKGGTIIRLQHMRTRKWLHSHLLNV
SLTMMPIDF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]