dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A069JVS4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A069JVS4|A0A069JVS4_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1487711 OS=Streptomyces sp. NTK 937. GN=DT87_16990 OC=Streptomyces.
Sequence length 124
Sequence
MALKVDESEQGAWTVLRIRGELDIASATAVRQSVHGAVADGRHDLVLDLAGVFFCDSSGV
NVLIATRRLMKSCGGRLRLILPARGAEDGSHVNKVLGALGVRRLFDVYPDAGAATDGVSR
PLGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]