dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A071LQH9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A071LQH9|A0A071LQH9_9PROT) 2-oxoglutarate:acceptor oxidoreductase {ECO:0000313|EMBL:KEA46521.1} KW=Complete proteome; Reference proteome OX=202 OS=Campylobacter mucosalis. GN=CR66_01355 OC=Campylobacteraceae; Campylobacter.
Sequence length 183
Sequence
MKSELRFVGVGGQGVILAGEILAAAKIESGGYGVKASTYTSQVRGGPTKVDIILDESEIL
YPYANEGEIDFMLATAQVSYDAFKSGVKEGGIIVVEPNLVKPSDDDKKRYKIYEIPIITI
AKEEVGNVITQSVVALGVAVAMSKCIDENIVKESMLSHVPAKVKEANEKAYELGLKYAKN
LIA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]