dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A073IMF4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A073IMF4|A0A073IMF4_9RHOB) Sulfate:proton symporter {ECO:0000313|EMBL:KEJ90775.1} KW=Complete proteome; Reference proteome OX=1300350 OS=Sulfitobacter donghicola DSW-25 = KCTC 12864 = JCM 14565. GN=DSW25_02350 OC=Rhodobacteraceae; Sulfitobacter.
Sequence length 572
Sequence
MSMTLSNYLPVLTWGRQYDRSALSNDLMAALIVTIMLIPQSLAYALLAGLPPEAGLYASI
VPIILYSMFGTSRALAVGPVAVVSLMTAAALSNIVEQGTMGYAVAALSLAGLSGVMLLAM
GLFRLGFIANFLSHPVIAGFITASGIIIAASQLKHIFGVDAHGHNLLDLVLSLAAHLSDI
NWITAVIGVLATGFLFWVRKGLKPMLEGLGLGETLTGVLVKTGPVAVVVLTTFAVWVFGL
ADRGVKIVGEVPQSLPPFTIPSFSPDLLGQLLLPAFLISIIGFVESISVAQTLAAKKRQR
IDPDQELIGLGAANIGASLTGGFPVTGGFSRSVVNFDAGAETPAAGAFTAVGLAIAALAL
TPLIYFLPKATLAATIIVAVLSLVDFSILKRSWDYSKADFAAVLVTILLTLIVGVEIGVS
AGVGLSILLHLYKSSKPHVAEVGQVPGTEHYRNILRHVVITEPSVVTLRVDESLYFANAR
FLEDKVYNRVAGDKEIRHVILQCSAINEIDLSALESLEMINNRLHEMDVKLHLSEVKGPV
MDRLKEQHFLQEMTGEIFLTQYEAAKTVSEKT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]