dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A074WW64 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A074WW64|A0A074WW64_9PEZI) F-actin capping protein {ECO:0000313|EMBL:KEQ77450.1} KW=Complete proteome; Reference proteome OX=1043004 OS=Aureobasidium namibiae CBS 147.97. GN=M436DRAFT_77337 OC=Aureobasidium.
Sequence length 264
Sequence
MADQFDSALDLLRRLNPKNTAANLSAICSLVPEHEEELLASVDQPLEVRRCKKSGRDYLL
CDYNRDGDSYRSPWSNEFDPPVDDAEMSSERVRRLEVRANEAFDVYRELYYEGGTSSVYL
WNLDDGFAGVVLLKKSSSQAAASGAWDSIHVLEVAERGRTAKYKLTSTVILNLGTKGDAL
GSLDLAGNMTRQVEADMSVDADETHVANIGKLVEDMELKMRNLLQEVYFGKAKDVVGDLR
SIPPLSEANRDRAAQREMISSMAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]