dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A075GD66 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A075GD66|A0A075GD66_9ARCH) Pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein (KorA) {ECO:0000313|EMBL:AIF01559.1} OX=1456013 OS=uncultured marine thaumarchaeote KM3_149_F07. GN=korA OC=Archaea; Thaumarchaeota; environmental samples.
Sequence length 635
Sequence
MAFDFSWLIGGPQGSGVDTAANIFSRVGAKLGYHVFGKREYHSNIKGLHSYFVVRLSDKK
IRSNINGANFMVAFDAETMIRHGLDVSKGGAIIYDSSIVNTTIDEIPTLETSYSVQLSEF
FSSKNMEPNVSSVIELAKQNGVKVYPISFRDTLANIADELKSPELSRMVRMFNVLGVSFS
LGVLKAPIEPLLESIDNIFSKKPSISDLNKKAANFSYNYASAKFSDFNNSISEISKEANT
IIVQGHQGSALGKMVCGCRFQSYYPITPASDESEFLESNEILNVKEDRPGSTTIVQTEDE
ISAIGMAVGASLTGTRSATSTSGPGFSLMAETLGWAGINETPIVITLFQRSGPSTGLPTR
HGQDDLLFAINAGHGEFPRIVYASGDVEDSFYDTGKCFNFADIFQVPVIHILDKFIASSV
VTCKRFEPDLVSIDRGKLLEKVDGDYKRFAHSPDGISPRSKLGLENGVFWNTGDESDEYG
HISEDPVNRIQMMDKRQKKVEQILTLIPKNDQAVAYGKSDICILSWGSPKGPILDAIEMH
RKEGHEIGFIDIKLLEPFPTEHVKSLLKDSSTIVDIEANMTAQLGSLIRKNLLKDPDYYV
LKYTGRPMTCIEIFDSLKKIIEKKAEKKQVLLYGN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]