dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A077F7T9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A077F7T9|A0A077F7T9_9PSED) ABC transporter permease {ECO:0000313|EMBL:AIL59361.1} KW=Complete proteome OX=237609 OS=Pseudomonas alkylphenolica. GN=PSAKL28_01230 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 380
Sequence
MEPMTTQASATLDTTSNPACLRIVGDWTLANYASLKRSSERLAGQYDQRTEIDLEQLGQL
DTAGASLLAELLGAERLSRLTETAQLPEASRALLQAVYCSVQDFCIPEKQPEKSVLIQLL
SRIGCAVDTLWQDTLQILGFVGLILQTLVLRLFQPRRWRVTAVVAHIEQTGLDAAPIVAL
LTFLVGAVVAFLGATVLAGFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIG
SMKANEEIDAIRTLGLDPVELLVVPRVLALLIALPLLTFLAMICGIIGGGVVCALSLDIS
PAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQS
IFVVIVLDAVAALFFMEMGW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]