dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A077XNE1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A077XNE1|A0A077XNE1_9SPHI) Sulfate permease family inorganic anion transporter {ECO:0000313|EMBL:CDS92482.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_1430886 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence length 377
Sequence
MSQVEQFKTVDASGVTHWLSGPSAYIMLGLTLFAAFVVYVFPKISKTIPASLIAILATFL
VVYIFRIDTKTVGDIASVKGNLPAFHIPELPFSWETLMIIFPFSLIMASVGLIESLLTLS
MVDELTNTKGNANREAMAQGAANLVNGFFGGMGGCAMVAQTLVNINAGSRSRLSGIIGAL
TILTIILVASPLIEQIPMAALVGVMMVVAIGTFQWVSFRIITKMPKSDIFVGMLVALITI
VLHNLALAVLVGVVIAALVFAWDNAKRIRARKTIDAAGNKVYEIYGPLFFGSVTGFLEKF
DINDDPQYVIVDFKESKITDMSAIDAVNKLAEKYQSQSKILRLRHLSEDCKAILKKAESP
VLIETSENDPTYRVMPK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]