dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A077Y8D7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A077Y8D7|A0A077Y8D7_9APIC) F-actin capping protein, alpha subunit, putative {ECO:0000313|EMBL:CDU19625.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_1246500 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence length 307
Sequence
MDSLLNEKKKFIRHVLSNAPPGKISDLISNLKTIFGSNAIIQNFIEDIISNYNEDNYILI
PFENNEYIIICKESKSGNLYLHPNLKILANVNHLKRKLIDTTPLVKLNHSDILEKYREVC
NNKLKEYVDIYYKKWNEHQIENYPTVNIGAKHGLNVKCASSVYASECENKYNLFFLICCD
RYYLKNFHASSWRSSWNVNFLEADQEIPLTGTVDIVLTYFEDANINFKTRKVFEKRVSVT
NDIENFASSILSVIRECENDVLYDLNHLIANTSSDLIKNTRKIIPLNGDKFYWMETYQDI
PTQIKLI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]