dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A078MGQ5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A078MGQ5|A0A078MGQ5_9BACI) RsbT antagonist protein RsbS {ECO:0000313|EMBL:CEA03851.1} OX=1461583 OS=Lysinibacillus saudimassiliensis. GN=BN1050_01714 OC=Lysinibacillus.
Sequence length 120
Sequence
MSLKVPILKLYDCLIVSIQWELDDHMAMMFQEDLLSKLYETGARGVVLDLTFVDFMDSYI
AKVIGDAINMATLMGAKLVLTGIQPPVAITLVELGISLNASSTALDLEKGLEQLQRELGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]