dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A084TNP4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A084TNP4|A0A084TNP4_9FLAO) Sulfate permease {ECO:0000313|EMBL:KFB02330.1} KW=Complete proteome; Reference proteome OX=1197477 OS=Mangrovimonas yunxiaonensis. GN=IA57_01455 OC=Flavobacteriaceae; Mangrovimonas.
Sequence length 540
Sequence
MASFIIKRTANVKNDVLSGITVALALVPEAVAFAFVAGVDPLVGLYAAFMIGLITAVFGG
RPGMISGATGALAVVMVSLVAEGNAMGAESENLGLYYLFATVILMGIIQMLAGVFKLGKF
VRLIPHPVMMGFVNGLAIVIFLSQLGMFKEVVNNEVVWMQGPRLWIMIALVALTMGIMYG
LPKLNKKLPEALIAILVVSAIVIFGGLEAATVGSFIRDGGGEGLKGGLPIFQADIFTKVP
MTWETLKFIGPYALILAAIGLIESLMTLNLIDELTETRGNTNRECLAQGGANIVTGLFGG
MGGCAMIGQSIINIKAGGRTRLSGIVAALGLLFFILFASGLIEQVPIAALVGVMFMVVIG
TFAWSSFRIVNKIPRSDLFVLVLVSGLTVIFDLAVAVIAGVIISALVFAWENAKRIRARK
RFKTDGTKVYEIWGPLFFGSVKAFNEKFDVKQDPDKVEIDFIESRVSDHSALEAIFNLVE
KYEAVGKKITLKHLSEDCKVLLYKASPKFKDVIEEAIDDPRYHLAENPEAFPKPLSEYKF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]