dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A085WQE0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A085WQE0|A0A085WQE0_9DELT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=394096 OS=Hyalangium minutum. GN=DB31_4945 OC=Cystobacterineae; Archangiaceae; Hyalangium.
Sequence length 341
Sequence
MSKPIQVLLTDDSPTMLQVLTRLLSAQPDVTVVGTARDGEEAVALARSLKPDVITLDVQM
PGMDGLGATERIMAETPCRILMVSGAPDTDLSFRALQAGALEVIAKPQGSPEDVARFGVR
LLSAIRLLAEVPLVTKRREGHANPPPLPAGRRIGGFGLFSSIGGPTALASLLWLLPRSLP
YPVFIAQHITPGFTVGLHRWLSSLSPLPVEIARASEQPRPGTVYLAPDGHHLRVGLQGEI
VIEKASGTTFPSGDLLLASLSRAYGQHAAGAVLSGMGEEGAVGLMAIKRAGGLTFAQDPE
TCLVPSMPEAALRNKSTETKVSPEALATIIRQLEGMSSSGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]