dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A086BL77 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A086BL77|A0A086BL77_9FLAO) Sulfate permease {ECO:0000313|EMBL:KFF29691.1} KW=Complete proteome; Reference proteome OX=558152 OS=Chryseobacterium piperi. GN=IQ37_04580 OC=Flavobacteriaceae; Chryseobacterium.
Sequence length 512
Sequence
MDTYTNIFSFSKKINYKNELLAGFTVAMTMIPESLSFAILAGLSPLTGLYAAFLMGLITA
VFGGRPGMVSGGAGATVVVLIALAKSHGVEYLFAAVALAGIFQILVGVFKLGKFVRLIPQ
PVMYGFLNGLAVIIFMAQVEQFKMTDSNGVVSWLQGASLYNMAGLTALTIGIVYFFPKIT
KAVPASLIAIIIVFALVFGLGIHTKTVGDIGHISGNLPQFHIPKVPFSLETLNIIFPYAL
IMSGVGLIESLLTLSMVDEITNSKGNANRESIAQGIANMTNGFFGGMGGCAMVAQTLVNL
NAGSRARLSGIIASITILGIILFGAPFIEKIPMAALVGVMMMVAISTFQWVSIRIVNKMP
KSDIFVGITVALITIVLHNLALAVLVGVVISALVFAWDNAKRIRAIKYIDDNGVKYYEIF
GPLFFGSVTAFADKFDPANDPDKVIVDFKESRVVDMSAVDALDKLSKRYHQYNKTLHLRH
LSEDCRKILKNAEAVIDVSIQDDPTYKVMPER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]