dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A086MI82 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A086MI82|A0A086MI82_9RHIZ) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1549810 OS=Microvirga sp. BSC39. GN=JH26_15695 OC=Methylobacteriaceae; Microvirga.
Sequence length 111
Sequence
MLSTDLRNNVLVVRVEEKRIDASRAPAFKDEMTRCIEAGQNQLVLDLSRVDFIDSSGLGA
LVSCLKRLGPRGSLAVAGATGAVSRLFTLTRMDRVFALHPDVDTAVEQLSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]