dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A087XJ87 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A087XJ87|A0A087XJ87_POEFO) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSPFOP00000005840} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence length 1289
Sequence
MRIQGQPEGARRRLDMNATGELRDVEVIRGRAGYGFTITGQKPCLLSGIMEGSPAFVVGL
RQGDRIMAINGADVSAASHETVVQLIGGCKGPLHMVVLSERRIMGNPILNDAKFGFEQKS
SVFQKPGVLRAVSHDPSRPSFDPNNGVTAKQRPVSEPDMSLWTQQFNVLSGKKKEETPTV
KDTDSVFSDTEEVNPDWSVLNMTLVVGYLSSTELILNTGDTEDDCLKAIRERIRQLGTEQ
DTHTLVMMKVMFDCIRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIINGRVP
DDGPLRASCHVFFIDPDLGNHKDHIGIACRFGFNCTPDPDSLGCLEFPQTPPDVLHFVTV
LYSDLGEAVERLRAKLDMEAQQTDSTSKLGSASSNGDSGIENSSPPEERADRDFPSDIPN
LSGTHLPSCPWDYPSTEVVTPVNPVKNGQKLEPENSASPHSLSESLPGPDSLTSFYGGPP
PRLEFHFKPPPPPLPLSKKPNFLAYPLRSSQRWFSKPKWPKTLSSDSVNQETSTNINSTT
NNPPSALNQAHSDRYHSTEAMMPPREEWTKRFLEQRQKQRADGSYRNLQKTTLDRKLSKL
QGSRFWGIGVTRASKRRSSKRLSMARSLDDLESAASSDGDYSGIQLQGCCSHSSLTSNGS
LPGAGGHRGSADHRVAGWSTCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHV
PATDKKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPQPEMFKTQQLQIFNLM
KFDSYSRFLKSSLYLECLRAEEDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKVDTQ
DIRKQRSGKSLNEDTKDESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDFWGSNGRRE
SQGSLSSSASLEIPNSVSAAKMEEQYKQRHCSVLLPDSSCSSITLRPGASIREVLQDLCR
NICVNIAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPT
KPVTEVLRPVVAKYGLNLGDLVAKISGETEPLDLGAPISSLDGLRVVLEQADPCSGKEIT
EKMLGRFAKDTNAITSDHQYHQLIIGQQKALIKTRSRQMDEGDERSAPKDISVRAAGPAS
ALPGEKRKQKKINIDEAEEFFELLSRAQSTRANDQRGLLKKEDLVLPDFLRLTPPTSSCS
ASSNLACSTPASLKPSRENGVPPRGSLTAALRSESLDSSLSSSANGHSASRRCLLPSLRT
VEEDAHADLTLVGEGDISSPNSTLLPPSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]