dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091BEK9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091BEK9|A0A091BEK9_9GAMM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1121013 OS=Arenimonas composti TR7-09 = DSM 18010. GN=P873_11435 OC=Xanthomonadaceae; Arenimonas.
Sequence length 711
Sequence
MRVALLARPGDARDQLRRALADAGAELVAEGDPAELDPGAVAGGQPGIVVVSLEPAIEEA
LERFDELLHADAIEVIYDDAEVTRQLDGWDLARWARHLAAKLTGATEVLPPAPEGQELHV
PVAAPADADDAPALELPEVDPAAIQPGAPPTPAQEMDAEKLEDYAAESLELSDWVPSNPS
LAAEPVEAPLAEANAAAGEEPSLELDLDLDLAGLEQALTAGADAAAPTLASALEASGIDV
PQQLDADEVPLHLEDTAAGAPASAEAPTAEVPLGLEDADAPLELEAADAPLDFDGGDAPL
DLEADDTPLDFDAGDVPLDFDPAGEAPLDLETSDEAPLDFASADEPMAFDGMEDTPLDFT
ADAAESEGPAADGDLDLDLDSGVDVPVAAGDDAPLPELEIGDGPVRFSTFTEDEQGAPAE
PAMDDDVAALAAQLEAFEANDTREMPREPDFANIALDPSPTPAAAAGPGRGAPAAPAAPA
AGGSLFDNLELVPMDADLGKVTAADANTPPAPSLAAVAEKRTVLNLAGENETRNVQAVSG
ALFVVAGLGGPDGVRQLLAALPPTLPVPVLLYQHLDTGKHERLVTQLSKASKLPLDLAVA
GKMAFPGRVAVLQPGIGISVRGEHVEFTEGSEGLAAVVAALPAADSAVLVLSGADPAVMP
AALALGAAGGLLLAQDPETCFDPVAPQAAIAAGGSTGAIAELARRIIERWS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]