dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091E1K5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091E1K5|A0A091E1K5_FUKDA) F-actin-capping protein subunit alpha-3 {ECO:0000313|EMBL:KFO36588.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_02042 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence length 299
Sequence
MAVSVLSRKEKERVIRRLLMQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYC
VPLCIDGNPVLLSHHNVMGDYRFFDQQSKLSFKFDLLQNQLKDIKSHGIIRNETEYLRTV
VLCALKLYVNDHYPAGNCNVLRKSIKNKEFLIACIEDHNYETGECWNGLWKSKWIFHVNP
FLTLVTGRIFVQAHFFRCVNLHIEISKDVKESLEVVNQAQLALSFARLVEEQENKFQAAV
CEELQELSNEVLKKNLRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]