dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091HTC8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091HTC8|A0A091HTC8_CALAN) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:KFO98389.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10473 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence length 273
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLSNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQ
VLITEHGDLGNGRFLDPRNKLSFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVK
DHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLK
IQVHYYEDGNVQLVSHKDIQDSIQVSSDVQTAKEFIKIIEHAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]