dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A091VKK4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A091VKK4|A0A091VKK4_NIPNI) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFR03902.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_04827 OC=Nipponia.
Sequence length 1354
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPTLCAGSSDNSVPKQRSFSDSAAVKFE
TGNESVSNPNLLSKEEISKVLNDDSVFRIGLESAEDFALDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGVARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDVDAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPTKHVPNSIWENPVGRGQNQPASHWNGFCHEQEGNI
PLEVIQNDKTQNVSKHLSPSARIEVPLVSSRNSVPPSKKNAAGIGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGPPHSIRKSKEDKKGAKFGHPMGLNQAPPPRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRKENGDYPNDSMQSNGLSYRRESQGSMSSTASLDLSEASRLPAFVPDKEKSPKYCC
VNLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQEPL
DLGVPISNLDGQRVVLDEKEPTKGRVFTDKQKGASVKQSATVTTSRNQVSTGEGRTLGKS
NSIKMKGENGKNAREVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQR
GLLRKEDLILPDFLRLPPTGPEPSSSTPAGPKGLNRRVSKNDGKDGCTSPSGKQESVQNF
NENSVKKMGYSENKHKSALTALHSQKTFSVPFNTALSPIPHAQENNATIWKRQSRELQAE
GIQMVDDENVADLTLVAEGDISSPNSTLLPPPPP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]