dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A093ZB17 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A093ZB17|A0A093ZB17_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY14541.1} KW=Complete proteome; Reference proteome OX=1420902 OS=Pseudogymnoascus sp. VKM F-4246. GN=V492_02567 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence length 767
Sequence
MASPSPAGSVRHRGNAAPTPKKGSSPTAATLAVPADKTLEKLARAKKAAPAAARSSEWDY
KLAIAVITVLAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFGKLLFALM
GWFVGYDGHFHFENIGDSYIANKVPYVAFRAMPALLGALTVPVVFDIMWESGYTLPACIV
ASGLVLFDNAHIGQTRLILLDATLVFAMACSLLCYIRFYKLRHQPFGRKWWKWLLLTGFA
LSCVISTKYVGTFAFLTVGAAVAIDLWDLLDVNRRQGALSLIDFGKHFAARAFGLIIVPF
MFYLFWFQVHFSILTKSGPGDDFMTPQFQETLSDNVMTSNAVTINYFDNIVLRHKETKTY
LHSHPDKYPLRYDDGRVSSQGQQVTGYPFNDTNNHWEILPADGQIVEGRVVKNHELVKLR
HIVTNTILLSHDVASPYYPTNQEFSTVPLDDAHGSRHNDTLFEIRIENGKPNQEFKSLSA
QFKLIHNPSKVAMWTHTTPLPDWAYKQQEINGNKNVAQSSNVWFVDEIPSIPVDSPRLQR
EARQVKTMPFLMKWFEVQRAMFHHNNALTSSHPYASQPFHWPFLLRGVSFWTHNDTRSQI
YFLGNPVGWWLASSLLAVYVGIIAADQLSLRRGADALDIRTRSRLYNSTGFFFIAWALHY
LPFYLMGRQLFLHHYLPAHLASCLVTGALVEFIFTIEPVEDASAAPGRVRDKVSGQSLLA
SWAAAGVIMIAVVGGWYFFVPLTYGFPLTVDEVMARKWLGYDLHFAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]