dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A096AY51 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A096AY51|A0A096AY51_9BACT) 2-oxoglutarate ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KGF51735.1} KW=Complete proteome OX=1401066 OS=Prevotella amnii DNF00058. GN=HMPREF9302_06295 OC=Prevotella.
Sequence length 180
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRIS
SPILSKYDVAIVLNQPSLDKFEEKVKPGGILIYEGNGIINPPTRTDIEIYRIDAVEKAAE
LKNSKVFNMIVLGGLLGVCPVVSNNGLEKALYKTLPERHHGLIPLNMQAVDEGKKIIRKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]