dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A099FD84 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A099FD84|A0A099FD84_9RHOB) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=690417 OS=Paracoccus sphaerophysae. GN=IC63_05920 OC=Rhodobacteraceae; Paracoccus.
Sequence length 347
Sequence
MRPVRVLIIDDSMTMRRLIRLALSGDPRIDVVGEARDAQQARERLGELRPDVLTLDVEMP
GQSGLDFLERLMAVRPMPVIMVSTETHHGTAAALEALSMGAVECVGKPVNAAAAADFAML
PDLVVAASTALIAPRPAGHQRPAGTPPPTGFIWNGRFVLIGSSTGGVDALERILSEYPSN
CPPTVITQHMPAGFLTSFAQRLNTRIRPTIQLASTGAPLLPGNVYLAPGGDTHLAISSPR
APVCHLVDADKRNGHRPSVDYLFETGAQLGDKAIAVMLTGMGRDGADGMLAMRRARAICL
AQDEATSVVWGMPRVAWESGAVDRLVPLPEIATQILSAAGRAMRAAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]