dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A099MZG7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A099MZG7|A0A099MZG7_9PSED) Aldo/keto reductase {ECO:0000313|EMBL:PBJ92916.1} KW=Complete proteome OX=70775 OS=Pseudomonas plecoglossicida. GN=CMV24_25005 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 336
Sequence
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRAEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNALDATLTRMDMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEACHIAERLGVPRPVVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPDAGSRAGRQDKRIMEVEW
RQESLAIARQIQAYVEAKGVGIVEFAIAWVLNNRLVSSAIVGPRTEEQWDTYGGALAVKI
TAEDEAFIDSLVTPGHASTPGFNDVAHFVSGRITVH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]