dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0A0AZV4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0A0AZV4|A0A0A0AZV4_CHAVO) Protein O-mannosyl-transferase 1 {ECO:0000313|EMBL:KGL99033.1} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_12417 OC=Charadrius.
Sequence length 728
Sequence
MLGFLKNPVVVTAEINVNLMALTVIGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGALCVPLAY
QILVELQFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHS
SFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLTVAGLHFWHMIGDQNLSNVSLMCHF
LARALALVIIPVAMYLSFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKASGFIGASLPEWGYRQLEVVGEKLS
KGYHQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDINKNLSFMAKFMELQWKILTLKNE
DTEHKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVVTWASANVAALVYTCLSLWYLI
RRRRKIYDIPEDAWQLWVSAGGICVGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLIPI
VLQHLGNHLCRSLLLKSMFSALIVAWFSSVYLVYRTFSPVTYGEPSLSVTELKDLRWKDS
WNILIRKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]