dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0A8LBC1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0A8LBC1|A0A0A8LBC1_9SACH) WGS project CCBQ000000000 data, contig 00058 {ECO:0000313|EMBL:CDO96362.1} KW=Complete proteome OX=1427455 OS=Kluyveromyces dobzhanskii CBS 2104. GN=KLDO_g4568.t1 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence length 724
Sequence
MVSKSSGFLPKSSDLRLRDRKDQFNGTENIEDFLRTNEPLDDKLTKQLKKPQSFLHRDHW
FHTFVCLALTVASFLLRFYKIDESNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIG
LGEYLAGFDGDFDFSSNSNYPKSVNFKAMRQFNAIFSALCTPLSFYTAKNLDLSMLTVYL
VGLMVCVEHSYIVLGKFILLDSMLLFFTVLTFYCLTQIYRSRKRQFTLQWLFWMFATGAS
IGCVCSVKWVGLFITGVVGIYTIVELYCLHCNKSISKTKYAGHWIVRVLALIVVPSALYM
LFFKIHFALLYKTGTGDSSTHSLFQANLEGTQIEPSPRDVAYGSQISMRSHGLSPGLLHS
HPQTYPDGSNQRQVTGYGHRDGNNDWIVKFSRSSGKANIPSHVSKGNYEVSGYGSDTMGD
FKDDWIIEIVEQLPTGNKTMENKQLIHPLTTNFRLKNKELGCYLAATGLSYPGWGYNQAE
IVCKYPWNYHDKSTWWNIEDHVNSNLHTDDTFTPPPSRFWKDFVVINFAMASSNNALVPD
LDKYDRLASEPWEWPTLHTGLRMCNWGDSTVKYYLLGSPFNTWLSTATLPILVILIFVQL
FRYQRQSLQFTEEKVWNVFVSAVLSFVGWVLHYIPFLLMGRVTYVHHYVPALFFAIMCFA
YVVDYTLSNFNRYLKVVTYILLYAGCVYVYWYFAPLCQGMPEANLNYLYLQLLPGWDVSN
AQFS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]