dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B0NTT5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B0NTT5|A0A0B0NTT5_GOSAR) Uncharacterized protein {ECO:0000313|EMBL:KHG16067.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_23299 OC=Gossypium.
Sequence length 220
Sequence
MAMGFLGFALFLFLSLDLDQGSPSSASAASSSSTSQNVEITYGTVLKLMHEKTKFRLHSH
DVPYGSGSGQQSVTGFPNVDDSNSYWIVRPEPDTSAKQGDTIPSGTIIRLQHMRTRKWLH
SHLHASPISGNLEVSCFGGESESDTGDYWRLIIEGSGKTWKQDQKIRLQHVDTGGYLHSH
DKKYARIAGGQQEVCGVREKRADNVWLAAEGVYLPVTKSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]