dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B1ZRK0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B1ZRK0|A0A0B1ZRK0_9SPHN) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KHK91904.1} KW=Complete proteome; Reference proteome OX=1348853 OS=Novosphingobium malaysiense. GN=LK12_08610 OC=Sphingomonadaceae; Novosphingobium.
Sequence length 648
Sequence
MATITAEHETEASVQDTAPEAVVVRFAGDSGDGMQLTGGQFTLSTALAGNDLATFPDFPA
EIRAPQGTLFGVSAFQINFGSQEITTAGDAPDVLVAMNPAALKVNVQALKPGGLVIADTG
EFSKRNLDKAKYETNPLEDDSLAKWDVLAFDISALTLEAVKPFGLGNKEALRCKNMWTLG
LALWMFDRDRQPLVDWLKNKFAKNPVLADANIAALNAGHAYGETAELAGPLKKLHVDPVP
SEPGLYRTITGAEAVSLGLVAGAQLADLPMFFGGYPITPASAILHNLVKMKEFGVTTFQA
EDEIAAICAAIGASYAGQLGVTSSSGPGIALKGEAMGLAVMTELPLVIVNSQRGGPSTGL
PTKTEQSDLYQAVYGRNGDASLPVVAARSPADAFECAIEACRIAVQFMTPVMLLTDGYIG
NASEPWKVPDPASFEPFPVSFLEKNNNPDGNVLPFKRDARGVRPWIKPGTEGLMHRIGGI
EKGIDTGNIDYAPQVHQAQTDARKAKVDGVAAAIPPQDVCLGEESGKLAVVGWGSTFGPI
HQAVRRARRKGMDVSHIHVRHVWPLPGNLGDLLKGFDKVLVPEMNTGQFKTVLRDQFLVD
ATPLSKTSGQPFAIAEIEEAIASYFDGVPGHAEGEVPVNETQLPNPEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]