dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B2JFG0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B2JFG0|A0A0B2JFG0_9BACT) Indolepyruvate oxidoreductase {ECO:0000313|EMBL:KHM44981.1} KW=Complete proteome OX=1501392 OS=Coprobacter secundus. GN=PU94_13705 OC=Coprobacter.
Sequence length 192
Sequence
MKTDIILSGVGGQGILSIAAIIGEAAVKNGLYMKQAEVHGMSQRGGDVQSNLRISDTPIA
SDLIPLGKADLILSLEPMEALRYLPYLSKDGWIVTNSAPFINIPNYPETEQIMAELNKIP
NKIILDVDRIAKENGSSRTANMVLLGAATPFLNIEYDKIADGIRFIFERKGNDIVEMNLK
ALAAGRYVADNQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]