dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B3SIT6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B3SIT6|A0A0B3SIT6_9RHOB) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=561184 OS=Mameliella alba. GN=OA50_04947 OC=Rhodobacteraceae; Mameliella.
Sequence length 384
Sequence
MSVKSVVIATPDAAQRKRLGLVVDRMSEFEVIAQTGDLMNTYNVVEERLPKAVLIADVLA
GLAEFEVMRALFSTLDIRWLVVTVPNRRLRRPAVGGSPRSDLFSIPTDAPDEVYERQLRA
LTRTGLNPRPAAKPNPLRPTETPHSHLTRGAPTTNATRPLITTVKVQDHLTRTSRASQAD
PRTPLGRDPIILIGASTGGVDALLAVLTRFPQDCPPTLVVQHTGSGFGESLASLLDRQCL
PNVLLANGPMPLRRGQILVGAGIRAHLVLDGRAATRVTTVADGPVAGHVPSVDRLFLSAL
PVAPRVSAALLTGMGRDGADGMKALRLAGAHTLAQDEASCVVYGMPRAAVELGGVDRVLP
LKKIAEALLARRKTNVGPGREVQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]