dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B4GH19 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B4GH19|A0A0B4GH19_9HYPO) Mannosyltransferase PMTI {ECO:0000313|EMBL:KID77116.1} KW=Complete proteome OX=1276141 OS=Metarhizium brunneum ARSEF 3297. GN=MBR_03435 OC=Metarhizium.
Sequence length 765
Sequence
MARSQTPQGSLRQRNVGSKKADSSTSAVDVELDKLAKASIKKNASNCERDHWAAFSLTTI
LAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKLLFAFMGWLVGYDGH
FHFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSVPACLIAAGLVLFDN
AHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDMSTKY
VGTFAFVTIGAAVIIDLWDLLDIKRPGGAISLPQFGRHFAARAVGLIILPFLFYLFWFQV
HFAVLSRSGPGDDFMSPEFQETLSDNAMLANAVDIQYYDTITIKHKETKAFLHSHPHQYP
LRYDDGRVSSQGQQVTGYPHNDTNNYWQILPSSDDKQMGRKVKNNELIRLRHVGTDTVLL
SHDVASPYYPTNQEFTTVSQDDAYGSRVNDTLFEIRIENGKNGQEFKTIASYFKLIHFPS
KVAMWTHTKPLPEWGSHQQEINGNKQIAPSSNIWLVDNIASLAADDARREKPERKVKTLP
FLRKWFELQRAMFYHNSKLTSSHPYASHPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WLASSLLAVYIGIVLADQISLRRGIDALDHRTRSRLYNSTGFFWVAWATHYFPFFVMGRQ
LFLHHYLPAHLASCLVAGALIEFVFSAEPVDETRGPRKSPKKHLTARERLAGQSMMGAWI
ACGVVLTIVIAGWWFFLPLTYGYPGLSVEQVVRRKWLGYDLHFAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]