dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B4HR10 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B4HR10|A0A0B4HR10_9HYPO) WASH complex, F-actin capping protein, beta subunit {ECO:0000313|EMBL:KIE01871.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_02093 OC=Metarhizium; Metarhizium majus.
Sequence length 283
Sequence
MAEIDPFDSALDLLRRLNPKHTASHLNAIISLAPDLAEDLLSSVDAPLMARRCKQSGREY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGADGNEGAGEGAIPSERVRKMEVKANDV
FDIYRDLYYEGGVSSVYLWNLDDGFAGVVLLKKSITPGRSTEGIWDSIHVFEAIERGRMT
HYKLTSTVILTLAAAGGSLGDMDLSGNMTRQVEQDMPVDGDDSHIVNVGRLVEDMELKMR
NLLQEVYFGKAKDVVGDLRSVGSLSDGARDREAQRELIGSMRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]